PTF1A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PTF1A Polyclonal antibody, PBS Only (30987-1-PBS)

• 

  WB analysis using 30987-1-AP (same clone as 30987-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30987-1-AP (PTF1A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30987-1-PBS in a different storage buffer formulation.

PTF1A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30987-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30987-1-PBS targets PTF1A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34321

  Product name: Recombinant human PTF1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 155-328 aa of NM_178161

  Sequence: VRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

• Full Name: pancreas specific transcription factor, 1a
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_178161
• Gene Symbol: PTF1A
• Gene ID (NCBI): 256297
• RRID: AB_3669807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7RTS3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.