PTGES Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PTGES Polyclonal antibody (10596-1-AP)

PTGES Polyclonal Antibody for WB, ELISA

Cat No. 10596-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:1.11.1.-, EC:2.5.1.18, EC:5.3.99.3, Glutathione peroxidase PTGES, Glutathione transferase PTGES

• 

  WB analysis using 10596-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10596-1-AP (PTGES antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, MDA-MB-468 cells, human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10596-1-AP targets PTGES in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0847

  Product name: Recombinant human PTGES protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC008280

  Sequence: MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

• Full Name: prostaglandin E synthase
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC008280
• Gene Symbol: PTGES
• Gene ID (NCBI): 9536
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14684
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human prostaglandin E synthase(PTGES) is a member of a recently recognized protein superfamily consisting of membrane associated proteins involved in eicosanoid and glutathione metabolism (the MAPEG family)(PMID:10377395). It is also named as MGST1L1, MPGES1, PGES, PIG12 and belongs to the MAPEG family. This protein is expressed in membranes as an approximately 16-kD protein(PMID:10091672).