Use Able AI chat for product recommendations

PTGR1 Polyclonal antibody

PTGR1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 13374-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

LTB4DH, PGR1, PRG 1, prostaglandin reductase 1, PTGR1, ZADH3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human colon tissue, human liver tissue, mouse liver tissue, HepG2 cells, rar liver tissue
Positive IP detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13374-1-AP targets PTGR1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4196

Product name: Recombinant human PTGR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-329 aa of BC035228

Sequence: MVRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA

Predict reactive species
Full Name prostaglandin reductase 1
Calculated Molecular Weight 329 aa, 36 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC035228
Gene Symbol PTGR1
Gene ID (NCBI) 22949
RRIDAB_2173213
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14914
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTGR1(Prostaglandin reductase 1) is also named as LTB4DH(NADP-dependent leukotriene B4 12-hydroxydehydrogenase) and belongs to the NADP-dependent oxidoreductase L4BD family. It catalyses the conversion of leukotriene B4 into biologically less reactive 12-oxo-leukotriene B4, a key step for its inactivation and it is a key oxidation step in the process of metabolic inactivation of leukotriene B(4) in various non-leukocyte tissues(PMID:8576264).

Protocols

Product Specific Protocols
IP protocol for PTGR1 antibody 13374-1-APDownload protocol
WB protocol for PTGR1 antibody 13374-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

J Biol Chem

Modulation of Nitro-Fatty Acid Signaling: Prostaglandin Reductase-1 is a Nitroalkene Reductase.

Authors - Vitturi Dario A DA
humanWB

Int J Biol Sci

NUCB2 promotes hepatocellular carcinoma cell growth and metastasis by activating the E2F4/PTGR1 axis

Authors - Yuan Wang
humanWB

Mol Cancer Ther

Conditional Dependency of LP-184 on Prostaglandin Reductase 1 is Synthetic Lethal in Pancreatic Cancers with DNA Damage Repair Deficiencies

Authors - Diana Restifo

Reviews

    5.0 out of 5
Add a review

5 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kristen (Verified Customer) (12-15-2025)

Used as positive control (known to be expressed in HeLa cells), no background/non-specific bands seen

  • Applications: Western Blot
  • Cell Tissue Type: HeLa

Casey (Verified Customer) (12-02-2025)

This antibody worked really well. Band was validated with siPTGR1 Knockdowns.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: melanoma cells

Haley (Verified Customer) (11-25-2025)

Highly recommended

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cancer cells

Jelan (Verified Customer) (10-31-2025)

We use this antibody for completing our western blots, and we are a big lab who do westerns alot and we have not had any issues with this specific protein and it seems to be blotting fine.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Rabbit / IgG

Diana (Verified Customer) (10-17-2025)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: melanoma
Loading...
||
New chat

Able

正在加载,请稍候...