Tested Applications
| Positive WB detected in | HeLa cells, human colon tissue, human liver tissue, mouse liver tissue, HepG2 cells, rar liver tissue |
| Positive IP detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13374-1-AP targets PTGR1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4196 Product name: Recombinant human PTGR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC035228 Sequence: MVRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA Predict reactive species |
| Full Name | prostaglandin reductase 1 |
| Calculated Molecular Weight | 329 aa, 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC035228 |
| Gene Symbol | PTGR1 |
| Gene ID (NCBI) | 22949 |
| RRID | AB_2173213 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14914 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PTGR1(Prostaglandin reductase 1) is also named as LTB4DH(NADP-dependent leukotriene B4 12-hydroxydehydrogenase) and belongs to the NADP-dependent oxidoreductase L4BD family. It catalyses the conversion of leukotriene B4 into biologically less reactive 12-oxo-leukotriene B4, a key step for its inactivation and it is a key oxidation step in the process of metabolic inactivation of leukotriene B(4) in various non-leukocyte tissues(PMID:8576264).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for PTGR1 antibody 13374-1-AP | Download protocol |
| WB protocol for PTGR1 antibody 13374-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PTGR1 Polyclonal antibody (Cat# 13374-1-AP) has 3 total citations. These appear in International Journal of Biological Sciences, Molecular Cancer Therapeutics, and Journal of Biological Chemistry. The associated research fields include hepatocellular carcinoma growth and metastasis, synthetic lethality in pancreatic cancer with DNA damage repair deficiencies, and nitro-fatty acid signaling involving prostaglandin reductase-1 as a nitroalkene reductase.
| Species | Application | Title |
|---|---|---|
Int J Biol Sci NUCB2 promotes hepatocellular carcinoma cell growth and metastasis by activating the E2F4/PTGR1 axis | ||
Mol Cancer Ther Conditional Dependency of LP-184 on Prostaglandin Reductase 1 is Synthetic Lethal in Pancreatic Cancers with DNA Damage Repair Deficiencies | ||
J Biol Chem Modulation of Nitro-Fatty Acid Signaling: Prostaglandin Reductase-1 is a Nitroalkene Reductase. |
Reviews
What customers say
All five reviews are 5-star ratings from Western Blot users. Reviewers report clean, specific bands with no background or non-specific signals. One user validated the band using siPTGR1 knockdowns, confirming target specificity. Another used it as a positive control in HeLa cells with excellent results. A high-throughput lab noted consistent performance across many blots without issues. Overall, customers find this antibody reliable, specific, and well-suited for routine Western blotting at a 1:1000 dilution.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kristen (Verified Customer) (12-15-2025) | Used as positive control (known to be expressed in HeLa cells), no background/non-specific bands seen
|
Casey (Verified Customer) (12-02-2025) | This antibody worked really well. Band was validated with siPTGR1 Knockdowns.
|
Haley (Verified Customer) (11-25-2025) | Highly recommended
|
Jelan (Verified Customer) (10-31-2025) | We use this antibody for completing our western blots, and we are a big lab who do westerns alot and we have not had any issues with this specific protein and it seems to be blotting fine.
|
Diana (Verified Customer) (10-17-2025) |
|
