Tested Applications
| Positive WB detected in | A431 cells, Neuro-2a cells, HeLa cells, THP-1 cells, C2C12 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13393-1-AP targets COX-1/Cyclooxygenase-1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4055 Product name: Recombinant human PTGS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-599 aa of BC029840 Sequence: KLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL Predict reactive species |
| Full Name | prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) |
| Calculated Molecular Weight | 599 aa, 69 kDa |
| Observed Molecular Weight | 60-72 kDa |
| GenBank Accession Number | BC029840 |
| Gene Symbol | PTGS1 |
| Gene ID (NCBI) | 5742 |
| RRID | AB_10644323 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23219 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PTGS1(Prostaglandin G/H synthase 1) belongs to the prostaglandin G/H synthase family and catalyzes the conversion of arachidonic acid to prostaglandin H2, which is subsequently metabolized to various biologically active prostaglandins. It is also named as COX1(Cyclooxygenase-1). There is no PTGS1 expression in fetal samples (prostate, seminal vesicles, or ejaculatory ducts), and only minimal expression in adult tissues (PMID: 10999846). PTGS1 has some isoforms with MW of 56-72 kD and PTGS1 can form homodimer.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX-1/Cyclooxygenase-1 antibody 13393-1-AP | Download protocol |
| IP protocol for COX-1/Cyclooxygenase-1 antibody 13393-1-AP | Download protocol |
| WB protocol for COX-1/Cyclooxygenase-1 antibody 13393-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
COX-1/Cyclooxygenase-1 polyclonal antibody (Cat# 13393-1-AP) has accumulated 44 citations across journals including Nature Communications, Cell Metabolism, Redox Biology, Theranostics, International Journal of Molecular Sciences, Free Radical Biology and Medicine, and eLife. The associated research fields span inflammation, mitochondrial biology, arachidonic acid and prostaglandin metabolism, cardiovascular disease, neurodegeneration, liver disease, renal injury, cancer, tendon healing, and platelet biology, with applications primarily in Western blot, immunohistochemistry, and immunofluorescence.
| Species | Application | Title |
|---|---|---|
Cell Metab m6A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1 | ||
Nat Commun FUS unveiled in mitochondrial DNA repair and targeted ligase-1 expression rescues repair-defects in FUS-linked motor neuron disease | ||
Redox Biol Iron overload exaggerates renal ischemia-reperfusion injury by promoting tubular cuproptosis via interrupting function of LIAS | ||
Acta Pharm Sin B Organic carbon monoxide prodrug, BW-CO-111, in protection against chemically-induced gastric mucosal damage. | ||
J Control Release A COX-2 PROTAC Nanodrug for osteoarthritis therapy via enhancing cartilage repair and reprogramming macrophage polarization. |
Reviews
What customers say
All three reviews are 5-star. Users report excellent performance in Western blot, with clear bands at the expected size and minimal background at 1:1000 dilution. One reviewer also confirmed strong results in immunohistochemistry and immunofluorescence at 1:600. Another provided a detailed IF protocol on HeLa cells using 1:200 dilution, achieving clean staining. Overall, customers consistently praise the antibody's specificity, precise band sizes, and reliable results across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Meixin (Verified Customer) (03-10-2026) | This antibody performs well in Western blot. A clear band was detected at the expected size with minimal background. Used at 1:1000 dilution and the results were consistent across experiments.
|
Mounika (Verified Customer) (01-08-2026) | Amazing antibodies, works very well, bands size are precise!
|
Thomas (Verified Customer) (09-18-2020) | HeLa cells were fixed in 4% PFA for 15 mins and permeabilised in 0.1% Triton-X 100 in PBS. Cells were blocked in 1% BSA. Primary antibody solution was diluted at 1:200 in blocking solution and incubated for 1 hour. Goat anti-rabbit 488 Alexa Fluor secondary antibody (1:250 - green) and DAPI (1:2000 - blue) were incubated with cells for 1 hour.
 |
