COX-1/Cyclooxygenase-1 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84151-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 84151-3-PBS against Human COX-1/Cyclooxygenase-1 was performed. The affinity constant is 1.09 nM.

COX-1/Cyclooxygenase-1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84151-3-PBS

Clone No.241373E7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

PGH1, PTGS1, COX1, Cyclooxygenase-1, EC:1.14.99.1

---

Product Information

84151-3-PBS targets COX-1/Cyclooxygenase-1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4055

  Product name: Recombinant human PTGS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-599 aa of BC029840

  Sequence: KLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

• Full Name: prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
• Calculated Molecular Weight: 599 aa, 69 kDa
• GenBank Accession Number: BC029840
• Gene Symbol: PTGS1
• Gene ID (NCBI): 5742
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23219
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.