Tested Applications
| Positive WB detected in | Jurkat cells, rat brain tissue, mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human kidney tissue, human brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:3000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17592-1-AP targets PYK2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11487 Product name: Recombinant human PTK2B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 646-1009 aa of BC042599 Sequence: KPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE Predict reactive species |
| Full Name | PTK2B protein tyrosine kinase 2 beta |
| Calculated Molecular Weight | 1009 aa, 116 kDa |
| Observed Molecular Weight | 112-115 kDa |
| GenBank Accession Number | BC042599 |
| Gene Symbol | PTK2B |
| Gene ID (NCBI) | 2185 |
| RRID | AB_10644483 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14289 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Proline-rich tyrosine kinase 2 (Pyk2; also known as CAK, RAFTK and CADTK) is a cytoplasmic tyrosine kinase implicated to play a role in several intracellular signaling pathways. It is expressed in many cells and tissues and migrated as a 130 kDa band in Western Blotting analysis. The size of PYK2 is 115 kDa, and it expressed in many cells and tissues and migrated as a 130 kDa band, but several lower molecular weight bands (75 kDa, 80 kDa, and 97 kDa) were seen in Western Blotting analysis, possibly due to proteolytic degradation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PYK2 antibody 17592-1-AP | Download protocol |
| IHC protocol for PYK2 antibody 17592-1-AP | Download protocol |
| IP protocol for PYK2 antibody 17592-1-AP | Download protocol |
| WB protocol for PYK2 antibody 17592-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PYK2 Polyclonal antibody (catalog number 17592-1-AP) has 19 citations. These appear in journals including Advanced Materials, Acta Pharmaceutica Sinica B, Molecular Biomedicine, Phytomedicine, EBioMedicine, Cell Chemical Biology, Molecular Medicine, Biomedical Pharmacotherapy, Brain, Behavior, and Immunity, Cancer Cell International, Cancer Gene Therapy, Communications Biology, Mucosal Immunology, International Journal of Cancer, Stem Cell Reviews and Reports, Cell Signaling, Immunology Letters, Journal of Pediatric Urology, and Journal of Ethnopharmacology. Research fields span oncology, cardiovascular disease, neurology, immunology, and renal disorders.
| Species | Application | Title |
|---|---|---|
Adv Mater Dual Single-Atom Engineered NADH Oxidase-Mimic Boosts In Situ NAD(+) Biotransformation for Targeted Myocardial Ischemia/Reperfusion Protection. | ||
Acta Pharm Sin B Macrophage DGKζ-mediated phosphatidic acid remodeling aggravates acute liver failure. | ||
Mol Biomed Microwave dynamic therapy induces ferroptosis in colorectal cancer by targeting PTK2B to regulate STAT3-mediated GPX4 expression. | ||
Phytomedicine Hedyotis diffusa injection suppresses breast cancer progression and lung metastasis through dual targeting of PTK2B and CCN2. | ||
EBioMedicine Biallelic mutations in LAMA5 disrupts a skeletal noncanonical focal adhesion pathway and produces a distinct bent bone dysplasia. | ||
Cell Chem Biol Differential network analysis of ROS1 inhibitors reveals lorlatinib polypharmacology through co-targeting PYK2 |
Reviews
What customers say
The single review for this product is highly positive, awarding it a 5-star rating. The reviewer describes it as a very good antibody that is easy to work with. It was successfully used across multiple applications, including Western Blot, Immunohistochemistry, and Immunofluorescence, at a 1:1000 dilution. Overall, the feedback highlights the antibody's reliability and user-friendliness across diverse experimental setups.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (09-08-2026) | very good antibody , easy to work with
|
