Tested Applications
| Positive WB detected in | PC-12 cells, A431 cells, Jurkat cells, PaTu 8988s cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:800-1:3200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17799-1-AP targets PTK7/CCK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12004 Product name: Recombinant human PTK7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 724-1070 aa of BC071557 Sequence: FYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP Predict reactive species |
| Full Name | PTK7 protein tyrosine kinase 7 |
| Calculated Molecular Weight | 1070 aa, 118 kDa |
| Observed Molecular Weight | 140-150 kDa |
| GenBank Accession Number | BC071557 |
| Gene Symbol | PTK7 |
| Gene ID (NCBI) | 5754 |
| RRID | AB_2878442 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13308 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Protein tyrosine kinase 7 (PTK7), also known as colon carcinoma kinase 4 (CCK4), is an atypical receptor tyrosine kinase that consists of an extracellular domain with seven immunoglobulin-like domains, a transmembrane domain, and a catalytically defective tyrosine kinase domain (PMID: 29867084). It is implicated in planar cell polarity and in the Wnt canonical and non-canonical pathways (PMID: 24618420). Overexpression of PTK7 has been reported in a variety of tumors, such as cervical cancer, colon cancer, lung adenocarcinoma, acute myelogenous leukemia, and gastric cancer (PMID: 30944666).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PTK7/CCK4 antibody 17799-1-AP | Download protocol |
| IP protocol for PTK7/CCK4 antibody 17799-1-AP | Download protocol |
| WB protocol for PTK7/CCK4 antibody 17799-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
PTK7 Antibody (Cat# 17799-1-AP) has 15 citations published in journals including Signal Transduction and Targeted Therapy, Nature Communications, Advanced Science, Cell Reports, Cell Death & Disease, Cell Death Discovery, Small Methods, Protein Science, Modern Pathology, Life Sciences, Neuro-Oncology Advances, Medicine in Science Monitor, and Clinical and Experimental Dental Research. Research fields span bone biology, glioblastoma, gastric cancer metastasis, hepatocellular carcinoma, melanoma, CAR-T immunotherapy, tumor imaging, and developmental biology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther The mechanosensitive adhesion G protein-coupled receptor 133 (GPR133/ADGRD1) enhances bone formation. | ||
Nat Commun Proximity extracellular protein-protein interaction analysis of EGFR using AirID-conjugated fragment of antigen binding | ||
Adv Sci (Weinh) CAR-Aptamers Enable Traceless Enrichment and Monitoring of CAR-Positive Cells and Overcome Tumor Immune Escape | ||
Adv Sci (Weinh) POSTN-Mediated Interplay of M1 Polarized Macrophage with Tendon-Derived Stem Cells to Drive Traumatic Heterotopic Ossification Formation through PTK7/ATK Signaling | ||
Cell Death Dis Periostin secreted by cancer-associated fibroblasts promotes cancer stemness in head and neck cancer by activating protein tyrosine kinase 7. | ||
Cell Death Discov MFAP2 secreted by TGF-β1-induced cancer-associated fibroblast cells promotes gastric cancer peritoneal metastasis through Src-STAT3-PTK7 axis. |
Reviews
What customers say
This product has received one user review. Gabriel Kim (January 2019) rated it 5 stars after using it for immunoprecipitation on MCF10A cells. No written comments were provided, but a representative IP image was shared demonstrating successful target pull-down. Overall, the single review reflects a positive experience with the antibody's performance in IP applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Gabriel (Verified Customer) (01-15-2019) |
 |
