PTK7 Recombinant monoclonal antibody

PTK7 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85075-1-RR
Clone No.242720A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

242720A5, CCK 4, CCK4, CCK-4, Colon carcinoma kinase 4

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, C2C12 cells, PC-12 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85075-1-RR targets PTK7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12026

Product name: Recombinant human PTK7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 724-1070 aa of BC071557

Sequence: FYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP

Predict reactive species
Full Name PTK7 protein tyrosine kinase 7
Calculated Molecular Weight 1070 aa, 118 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC071557
Gene Symbol PTK7
Gene ID (NCBI) 5754
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13308
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein tyrosine kinase 7 (PTK7), also known as colon carcinoma kinase 4 (CCK4), is an atypical receptor tyrosine kinase that consists of an extracellular domain with seven immunoglobulin-like domains, a transmembrane domain, and a catalytically defective tyrosine kinase domain (PMID: 29867084). It is implicated in planar cell polarity and the Wnt canonical and non-canonical pathways (PMID: 24618420). Overexpression of PTK7 has been reported in a variety of tumors, such as cervical cancer, colon cancer, lung adenocarcinoma, acute myelogenous leukemia, and gastric cancer (PMID: 30944666).

Protocols

Product Specific Protocols
WB protocol for PTK7 antibody 85075-1-RRDownload protocol
IHC protocol for PTK7 antibody 85075-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...