Prothymosin Alpha Polyclonal antibody

Prothymosin Alpha Polyclonal Antibody for IHC, ELISA
Cat No. 10480-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IHC, ELISA

Prothymosin alpha, N-terminally processed, prothymosin, alpha, PTMA, Thymosin alpha-1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman thyroid cancer tissue, human lymphoma tissue, rat colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:100-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10480-1-AP targets Prothymosin Alpha in IHC, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0732

Product name: Recombinant human PTMA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-110 aa of BC003510

Sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNANEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD

Predict reactive species
Full Name prothymosin, alpha
Calculated Molecular Weight 12 kDa
GenBank Accession NumberBC003510
Gene Symbol Prothymosin Alpha/PTMA
Gene ID (NCBI) 5757
RRIDAB_2174388
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06454
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prothymosin alpha (PTMA) is a nuclear protein possessing a number of cellular functions including cell survival. PTMA is identified to be localized in the nuclei of neurons, while it is found in both nuclei and cytoplasm in the astrocytes and microglia of adult brai. PTMA inhibits the neuronal necrosis induced by serum-free starvation or ischemia-reperfusion stress, which causes a rapid internalization of GLUT1/4, leading a decrease in glucose uptake and cellular ATP levels. Extensive research on PTMA showed that it is of clinical significance and potential medical use as they may serve as a molecular marker for cancer prognosis and/or as therapeutic agents for treating immunodeficiencies, autoimmune diseases and malignancies.

Protocols

Product Specific Protocols
IHC protocol for Prothymosin Alpha antibody 10480-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...