Featured Product
KD/KO Validated

PTN Polyclonal antibody

PTN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27117-1-AP

Publications (13)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

Synonyms

pleiotrophin, Heparin-binding neurite outgrowth-promoting factor, Heparin-binding growth-associated molecule, Heparin-binding growth factor 8, Heparin-binding brain mitogen

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis of fetal human brain using 27117-1-AP
fetal human brain tissue were subjected to SDS PAGE followed by western blot with 27117-1-AP (PTN Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of U-87 MG using 27117-1-AP
U-87 MG (WT and PTN KO) lysates prepared with RIPA buffer, 25μg protein loaded. 55011-1-AP incubated at 1:500 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown for each blot. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
×
U-87 MG (WT and PTN KO) lysates prepared with RIPA buffer, 25μg protein loaded. 55011-1-AP incubated at 1:500 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown for each blot. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
IP experiment of U-87 MG using 27117-1-AP
U-87 MG lysates prepared and IP of APP performed using 2.0 μg of 25524-1-AP coupled to protein A- magnetic beads. The Ponceau stained transfers of each blot are shown. SM=2% starting material; UB=2% unbound fraction; IP=immunoprecipitate. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
×
U-87 MG lysates prepared and IP of APP performed using 2.0 μg of 25524-1-AP coupled to protein A- magnetic beads. The Ponceau stained transfers of each blot are shown. SM=2% starting material; UB=2% unbound fraction; IP=immunoprecipitate. These data were performed and provided by YCharOS in partnership with Proteintech. YCharOS is an open science company with a mission to characterise all commercial antibodies to improve scientific reproducibility and transparency.
IHC staining of human brain using 27117-1-AP
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27117-1-AP (PTN antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 27117-1-AP
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27117-1-AP (PTN antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PTN in ?

Overview

Tested Applications
Product Information
Publications (13)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	fetal human brain tissue, U-87 MG cells
Positive IHC detected in	human brain tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27117-1-AP targets PTN in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, mouse, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26004 Product name: Recombinant human PTN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 94-168 aa of BC005916 Sequence: QFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD Predict reactive species
Full Name	pleiotrophin
Calculated Molecular Weight	18 kDa
Observed Molecular Weight	17-19 kDa
GenBank Accession Number	BC005916
Gene Symbol	PTN
Gene ID (NCBI)	5764
RRID	AB_2880763
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P21246
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pleiotrophin (PTN) is a multifunctional, cationic, glycosaminoglycan-binding cytokine and growth factor involved in numerous physiological and pathological processes, including tissue repair and inflammation-related diseases. PTN is highly upregulated in the brain in different disorders characterized by overt neuroinflammation such as neurodegenerative diseases, drug addiction, traumatic injury, and ischemia. PTN is important for CNS repair and for survival and differentiation of dopaminergic neurons.

Protocols

Product Specific Protocols
IHC protocol for PTN antibody 27117-1-AP	Download protocol
WB protocol for PTN antibody 27117-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-Pleiotrophin (PTN) antibody (Cat# 27117-1-AP) has 13 total citations. Citations appear in journals including Nature Communications, Science Bulletin, Cell Reports, MedicalComm, International Journal of Biological Macromolecules, World Journal of Gastroenterology, Cell Biosciences, Oncology Reports, Acta Biochimica et Biophysica Sinica, Journal of Oral Rehabilitation, Oral Diseases, Discovery Oncology, and Burns. Research fields span neuroscience, oncology, developmental biology, cardiology, oral biology, and wound healing.

Species	Application	Title
pig	IF	Sci Bull (Beijing) Single-cell dynamics of liver development in postnatal pigs Authors - Lin Rao View Article
mouse	WB,IF	Nat Commun Astrocytic pleiotrophin deficiency in the prefrontal cortex contributes to stress-induced depressive-like responses in male mice Authors - Dongmei Chi View Article
mouse	IF	MedComm (2020) Long-Term High-Fat Diet Affected Bone Marrow Microenvironment During Aging at Single-Cell Resolution. Authors - Yidan Pang View Article
		Int J Biol Macromol Integrative spatial multi-omics identifies the TEK receptor tyrosine kinase as a central biomacromolecule of endothelial-immune interactions in glioblastoma Authors - Zhao Yu View Article
	IF	Cell Rep Dissecting the spermatogonial stem cell niche using spatial transcriptomics Authors - Shreya Rajachandran View Article
human	WB,IHC	World J Gastroenterol ICAM2 loss drives 5-fluorouracil resistance via TGF-β/Smad/SP1/PTN-dependent apoptosis evasion and macrophage remodeling in gastric cancer. Authors - Xiao-Cheng Tang View Article