PTOV1 Polyclonal antibody

• 

  WB analysis using 16575-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16575-1-AP (PTOV1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PTOV1 Polyclonal Antibody for WB, ELISA

Cat No. 16575-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ACID2, Activator interaction domain-containing protein 2, PP642, prostate tumor overexpressed 1, Prostate tumor-overexpressed gene 1 protein

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16575-1-AP targets PTOV1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9859

  Product name: Recombinant human PTOV1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 57-416 aa of BC042921

  Sequence: MEGARVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVSAIRQVITTRKQAVGPGGVNSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTEQWPRKLYMQLIPQQLLTTLVPLFRNSRLVQFHFTKDLETLKSLCRIMDNGFAGCVHFSYKASCEIRVLMLLYSSEKKIFIGLIPHDQGNFVNGIRRVIANQQQVLQRNLEQEQQQRGMGG

• Full Name: prostate tumor overexpressed 1
• Calculated Molecular Weight: 416 aa, 47 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC042921
• Gene Symbol: PTOV1
• Gene ID (NCBI): 53635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YD1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTOV1 is a dual-domain adaptor and transcriptional co-regulator that promotes cell proliferation and oncogenic signaling through interactions with E2F1, RSK, and Mediator components. Shuttling between cytoplasm and nucleus, it integrates growth factor and differentiation pathways to balance proliferation and differentiation. Overexpressed in multiple cancers-most prominently prostate carcinoma-PTOV1 is linked to tumor progression, therapy resistance, and poor prognosis, positioning it as a potential biomarker and therapeutic target in epithelial malignancies. (PMID: 15713644)