PTPIP51 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PTPIP51 Monoclonal antibody (68582-1-Ig)

PTPIP51 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68582-1-Ig

Clone No.1G11E2

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FAM82A2, 1G11E2, FAM82C, hRMD 3, hRMD-3

• 

  WB analysis using 68582-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68582-1-Ig (PTPIP51 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 68582-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68582-1-Ig (PTPIP51 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 68582-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 68582-1-Ig (PTPIP51 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 68582-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 68582-1-Ig (PTPIP51 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 68582-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PTPIP51 antibody (68582-1-Ig, Clone: 1G11E2 ) at dilution of 1:476 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: LNCaP cells, HepG2 cells, HuH-7 cells, HT-29 cells, HEK-293 cells, K-562 cells
• Positive IHC detected in: human appendicitis tissue, mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:238-1:952

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68582-1-Ig targets PTPIP51 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15135

  Product name: Recombinant human PTPIP51 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-141 aa of BC008970

  Sequence: ESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCH

• Full Name: family with sequence similarity 82, member A2
• Calculated Molecular Weight: 470 aa, 52 kDa
• Observed Molecular Weight: 52-60 kDa
• GenBank Accession Number: BC008970
• Gene Symbol: PTPIP51
• Gene ID (NCBI): 55177
• RRID: AB_3085282
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96TC7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein tyrosine phosphatase-interacting protein 51 (PTPIP51),also known as RMDN3, is a mitochondrial membrane-anchored protein that interacts with ER membrane-bound VAPB. The VAPB-PTPIP51 interaction impacts on intracellular Ca2+ handling (PMID: 22131369, 28345618). PTPIP51 participates in multiple cellular processes, and dysfunction of PTPIP51 is implicated in diseases such as cancer and neurodegenerative disorders (PMID: 28345618).The known initiation sites in the Ptpip51 gene would lead to molecular protein masses of 52, 38 and 30 kDa (PMID: 18854601,19844996).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Cell Rep; Neurons and astrocytes have distinct organelle signatures and responses to stress.; Authors - Shannon N. Rhoads