PTPN18 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83024-1-RR (same clone as 83024-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 83024-1-RR (PTPN18 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83024-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 83024-1-RR (same clone as 83024-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83024-1-RR (PTPN18 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83024-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 83024-1-RR (same clone as 83024-1-PBS)

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug PTPN18 Recombinant antibody (83024-1-RR, Clone:230154G8) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83024-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83024-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83024-1-RR against Human PTPN18 were performed. The affinity constant is 7.48 nM.

PTPN18 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 83024-1-PBS

Clone No.230154G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

Tyrosine-protein phosphatase non-receptor type 18, PTP HSCF, EC:3.1.3.48, Brain-derived phosphatase, BDP1

---

Product Information

83024-1-PBS targets PTPN18 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34048

  Product name: Recombinant human PTPN18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-351 aa of BC052800

  Sequence: VQKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV

• Full Name: protein tyrosine phosphatase, non-receptor type 18 (brain-derived)
• Calculated Molecular Weight: 460 aa, 50 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC052800
• Gene Symbol: PTPN18
• Gene ID (NCBI): 26469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99952
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTPN18 (also called PTP-HSCF or BDP1), a member of the protein tyrosine phosphatase superfamily, has been reported to be a tumor suppressor in breast cancer by dephosphorylating HER2 and suppressing cell proliferation and invasion. In addition to the well-established role of PTPN18 in breast cancer, our previous study found that PTPN18 and CSK cooperate to inhibit the events triggered by SRC kinases. (PMID: 35982039)