PTPN22 Recombinant monoclonal antibody, PBS Only (Capture)

PTPN22 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85062-2-PBS
Clone No.242688G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

242688G1, EC:3.1.3.48, Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP, LyP, LYP1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85062-2-PBS targets PTPN22 as part of a matched antibody pair:

MP01818-1: 85062-2-PBS capture and 85062-3-PBS detection (validated in Cytometric bead array)

MP01818-2: 85062-2-PBS capture and 85062-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2397

Product name: Recombinant human PTPN22 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-179 aa of BC017785

Sequence: MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKEAEKRKSDYIIRTLKVKFNSVSVILAHQTSLQNLFSQITPAHF

Predict reactive species
Full Name protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Calculated Molecular Weight 82 kDa, 92 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC017785
Gene Symbol PTPN22
Gene ID (NCBI) 26191
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y2R2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PTPN22(Tyrosine-protein phosphatase non-receptor type 22) is also named as LyP,PEP,PTPN8.It belongs to the protein-tyrosine phosphatase family and non-receptor class 4 subfamily.It acts as negative regulator of T-cell receptor (TCR) signaling.Defects in PTPN22 are a cause of susceptibility to systemic lupus erythematosus (SLE). It has some isoforms produced by alternative splicing with calculated molecular mass of 79-92 kDa, and apparent molecular mass of 100-110 kDa.

Loading...
||
New chat Able
正在加载,请稍候...