PTPN9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PTPN9 Polyclonal antibody (12109-1-AP)

PTPN9 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12109-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

MEG2, EC:3.1.3.48, Protein-tyrosine phosphatase MEG2, PTPase MEG2, PTPaseMEG2

• 

  WB analysis of mouse pancreas using 12109-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 12109-1-AP (PTPN9 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 12109-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 12109-1-AP (PTPN9 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 12109-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 12109-1-AP (PTPN9 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12109-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12109-1-AP (PTPN9 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Transfected HEK-293 using 12109-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 12109-1-AP (PTPN9 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Transfected HEK-293 using 12109-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 12109-1-AP (PTPN9 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 12109-1-AP

  IP result of anti-PTPN9 (IP:12109-1-AP, 4ug; Detection:12109-1-AP 1:300) with HEK-293 cells lysate 1800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12109-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12109-1-AP (PTPN9 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12109-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12109-1-AP (PTPN9 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 12109-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 12109-1-AP (PTPN9 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 12109-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 12109-1-AP (PTPN9 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 12109-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 12109-1-AP (PTPN9 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 12109-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 12109-1-AP (PTPN9 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PTPN9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, Transfected HEK-293 cells, mouse liver tissue, mouse pancreas tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human liver cancer tissue, human placenta tissue, rat kidney tissue, mouse kidney tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12109-1-AP targets PTPN9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2754

  Product name: Recombinant human PTPN9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 248-593 aa of BC010863

  Sequence: FQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ

• Full Name: protein tyrosine phosphatase, non-receptor type 9
• Calculated Molecular Weight: 593 aa, 68 kDa
• Observed Molecular Weight: 68-70 kDa
• GenBank Accession Number: BC010863
• Gene Symbol: PTPN9
• Gene ID (NCBI): 5780
• RRID: AB_2877826
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43378
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPN9, Tyrosine-protein phosphatase non-receptor type 9, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN9 is involved in the transfer of hydrophobic ligands or in functions of the Golgi apparatus (PMID: 19167335). MiR-96 inhibits PTPN9 expression and consequently promotes proliferation, migration and invasion of breast cancer cells (PMID:27857177). PTPN9 can be detected double bands (PMID: 22394684). PTPN9 was located in cytoplasm and nucleus in human breast cancer (PMID: 23418360).

Publications

What published studies show

The PTPN9 Polyclonal antibody (Cat# 12109-1-AP) has 2 citations. These appear in Mol Ther Nucleic Acids and FASEB J. The cited research spans two fields: one study investigated microRNA-126's role in angiogenesis and neurogenesis in a mouse model of focal cerebral ischemia, while the other examined how PTPN9 promotes melanoma progression by regulating the ferroptosis pathway in human samples. Both citations used Western blot as the application.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Ther Nucleic Acids; MicroRNA-126 Regulates Angiogenesis and Neurogenesis in a Mouse Model of Focal Cerebral Ischemia.; Authors - Meijie Qu
human	WB	FASEB J; PTPN9 promotes melanoma progression by regulating the ferroptosis pathway; Authors - Hongmei Wang ; KD Validated