PTPRD Polyclonal antibody

PTPRD Polyclonal Antibody for WB, IHC, ELISA
Cat No. 27941-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

PTPD, Protein-tyrosine phosphatase delta, HPTPD, HPTP DELTA, HPTP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHuH-7 cells, human placenta tissue, mouse liver tissue, rat liver tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27941-1-AP targets PTPRD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27689

Product name: Recombinant human PTPRD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1089-1225 aa of BC106714

Sequence: GNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTNKQLQSGQEY

Predict reactive species
Full Name protein tyrosine phosphatase, receptor type, D
Calculated Molecular Weight 1912 aa, 215 kDa
Observed Molecular Weight75 kDa, 175 kDa
GenBank Accession NumberBC106714
Gene Symbol PTPRD
Gene ID (NCBI) 5789
RRIDAB_3086013
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23468
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPRD is a receptor-type protein tyrosine phosphatase that plays significant roles in various biological processes, including cell adhesion, synaptic function, and signal transduction. PTPRD is highly expressed in the brain, followed by the kidney, ovary, placenta, and intestine. Within the brain, it is found in specific regions, suggesting a role in neurological functions. PTPRD has emerged as a potential therapeutic target for various brain phenotypes and disorders. Its genetic variations have been associated with nervous system phenotypes, and the discovery of the first small molecule inhibitor of PTPRD phosphatase has opened new avenues for therapeutic intervention in addiction and possibly other PTPRD-associated disorders. Additionally, PTPRD is considered a tumor-suppressor gene that is down-regulated in hepatocellular carcinoma, suggesting its role in cancer progression and potential as a therapeutic target. The protein can recognize 175 kDa full length and 75 kDa mature cleavage product (PMID: 19074898, PMID: 25113440).

Protocols

Product Specific Protocols
IHC protocol for PTPRD antibody 27941-1-APDownload protocol
WB protocol for PTPRD antibody 27941-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...