Tested Applications
| Positive WB detected in | HEK-293 cells, HL-60 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12161-1-AP targets PTPRO in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2802 Product name: Recombinant human PTPRO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 298-597 aa of BC035960 Sequence: YWWDSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVVIFP Predict reactive species |
| Full Name | protein tyrosine phosphatase, receptor type, O |
| Calculated Molecular Weight | 138 kDa |
| Observed Molecular Weight | 180-220 kDa |
| GenBank Accession Number | BC035960 |
| Gene Symbol | PTPRO |
| Gene ID (NCBI) | 5800 |
| RRID | AB_2877831 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16827 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PTPRO(receptor-type tyrosine-protein phosphatase O) is also named as GLEPP1, PTPU2 and belongs to the protein-tyrosine phosphatase family. The protein is a receptor-like membrane protein tyrosine phosphatase expressed at the apical membrane of the podocyte foot processes in the kidney(PMID:21722858). The 1,159-amino acid predicted mature protein contains a large extracellular domain, a single transmembrane domain, and a single intracellular PTPase domain. Defects in PTPRO are the cause of nephrotic syndrome type 6 (NPHS6). In reducing conditions, PTPRO can form a smear from 180 to 220 kDa; In non-reducing conditions, a band appeares around 350 kDa, which likely represents the dimeric form of full-length PTPRO (PMID: 19573017).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PTPRO antibody 12161-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PTPRO antibody (Cat# 12161-1-AP) has 13 citations published in journals including J Hepatol, Hepatology, Cancer Lett, Cancer Commun, Cancer Cell Int, JCI Insight, Oncotarget, Front Pharmacol, J Cell Physiol, Tumour Biol, and Cell Physiol Biochem. Research fields span hepatology (liver injury, fibrosis, steatosis), oncology (colorectal, esophageal, lung, breast, and hepatocellular cancers), neurology (chemotherapy-related cognitive impairment), inflammation, lipid metabolism, and preeclampsia.
| Species | Application | Title |
|---|---|---|
J Hepatol PTPRO plays a dual role in hepatic ischemia reperfusion injury through feedback activation of NF-κB. | ||
Cancer Commun (Lond) PTPRO represses colorectal cancer tumorigenesis and progression by reprogramming fatty acid metabolism. | ||
Hepatology Estrogen-sensitive PTPRO expression represses hepatocellular carcinoma progression by control of STAT3. | ||
Cancer Lett PTPRO suppresses lymph node metastasis of esophageal carcinoma by dephosphorylating MET
| ||
Cancer Cell Int Circulating extracellular vesicle PTPRO methylation: an exploratory biomarker for minimally invasive diagnosis of early-stage lung adenocarcinoma. | ||
JCI Insight Age-related decline in hippocampal tyrosine phosphatase PTPRO is a mechanistic factor in chemotherapy-related cognitive impairment
|
Reviews
What customers say
All three reviews rate the antibody 5 stars for Western blot use with melanoma cell lines. Users report strong, clean signals and reliable performance, with one noting a 1:1000 dilution worked well. Overall, customers found it effective and consistent for WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jelan (Verified Customer) (02-04-2026) | It works well for Western blot applications with melanoma cell lines.
|
Haley (Verified Customer) (10-13-2025) | Strong, clean signal on Western blot
|
Haley (Verified Customer) (10-13-2025) | Worked well for Western blot application.
|
