PTRH1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PTRH1 Polyclonal antibody (17651-1-AP)

• 

  WB analysis using 17651-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17651-1-AP (PTRH1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PTRH1 Polyclonal Antibody for WB, ELISA

Cat No. 17651-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C9orf115, EC:3.1.1.29, Peptidyl-tRNA hydrolase, PTH, PTH1

---

Tested Applications

• Positive WB detected in: COLO 320 cells, Caco-2 cells, HeLa cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17651-1-AP targets PTRH1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11893

  Product name: Recombinant human PTRH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-214 aa of BC047012

  Sequence: MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLILDHIRERSQGPSLGP

• Full Name: peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 214 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC047012
• Gene Symbol: PTRH1
• Gene ID (NCBI): 138428
• RRID: AB_3741927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86Y79
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peptidyl-tRNA hydrolase 1 homolog(PTRH1), also known as PTH1, is peptidyl-tRNA hydrolase that cleaves nascent chains-tRNAs that are not stably fixed in the P-site of 60S ribosome-nascent chain complexes. PTRH1 functions in the ribosome-associated quality control (RQC) pathway and is involved in the degradation of nonubiquitinated nascent chain (NC) polypeptides arising from interrupted translation(PMID:30244831).