PTRH2 Recombinant monoclonal antibody, PBS Only (Capture)

PTRH2 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 86343-2-PBS
Clone No.251056C4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Bcl-2 inhibitor of transcription 1, BIT1, CGI 147, CGI-147, EC:3.1.1.29

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86343-2-PBS targets PTRH2 as part of a matched antibody pair:

MP02359-1: 86343-2-PBS capture and 86343-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0839

Product name: Recombinant human PTRH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC006807

Sequence: MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY

Predict reactive species
Full Name peptidyl-tRNA hydrolase 2
Calculated Molecular Weight 19 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC006807
Gene Symbol PTRH2
Gene ID (NCBI) 51651
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y3E5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PTRH2 (Peptidyl-tRNA Hydrolase 2, also known as Bcl-2 Inhibitor of Transcription 1 or BIT1) is a highly conserved protein that plays crucial roles in various cellular processes, including protein synthesis, cell survival, and cell death.

Loading...
||
New chat Able
正在加载,请稍候...