PUM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PUM1 Polyclonal antibody (26256-1-AP)

• Featured Product
• KD/KO Validated

PUM1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 26256-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

HSPUM, KIAA0099, PUM1, PUMH, PUMH1, Pumilio 1, Pumilio homolog 1, pumilio homolog 1 (Drosophila), PUML1

• 

  WB analysis of MCF-7 using 26256-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26256-1-AP (PUM1 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 26256-1-AP

  IP result of anti-PUM1 (IP:26256-1-AP, 4ug; Detection:26256-1-AP 1:300) with MCF-7 cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 26256-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 26256-1-AP (PUM1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: MCF-7 cells
• Positive IP detected in: MCF-7 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26256-1-AP targets PUM1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24651

  Product name: Recombinant human PUM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC013398

  Sequence: MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDEL

• Full Name: pumilio homolog 1 (Drosophila)
• Calculated Molecular Weight: 1186 aa, 126 kDa
• Observed Molecular Weight: 130-140 kDa
• GenBank Accession Number: BC013398
• Gene Symbol: PUM1
• Gene ID (NCBI): 9698
• RRID: AB_2880448
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14671
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PUM1, also named as Pumilio homolog 1, is a 1186 amino acid protein, which is expressed in brain, heart, kidney, muscle, intestine and stomach. PUM1 as sequence-specific RNA-binding protein that acts as a post-transcriptional repressor by binding the 3'-UTR of mRNA targets. PUM1 binds to an RNA consensus sequence, the Pumilio Response Element (PRE), 5'-UGUANAUA-3', that is related to the Nanos Response Element (NRE). The calculated molecular weight of PUM1 is 126 kDa, but the modified PUM1 is about 130-140 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Biochem Biophys Res Commun; PUM1 promotes ovarian cancer proliferation, migration and invasion.; Authors - Xue Guan ; KD Validated
human	WB	Carcinogenesis; PAUF/ZG16B promotes colorectal cancer progression through alterations of the mitotic functions and the Wnt/β-catenin pathway.; Authors - Beatriz Escudero-Paniagua
pig	WB	Cell Mol Life Sci; Prolyl endopeptidase is a multifunctional host factor required for FMDV infection.; Authors - Kun Ma ; KD Validated