PURB Polyclonal antibody

• 

  WB analysis using 18128-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18128-1-AP (PURB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 18128-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18128-1-AP (PURB Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 18128-1-AP

  IP result of anti-PURB (IP:18128-1-AP, 4ug; Detection:18128-1-AP 1:3000) with HeLa cells lysate 1360 ug.

• Featured Product
• KD/KO Validated

PURB Polyclonal Antibody for WB, IP, ELISA

Cat No. 18128-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF, IP, ChIP, RIP, ELISA

Synonyms

PURB, PURBETA

---

Tested Applications

• Positive WB detected in: C2C12 cells, mouse liver tissue, HeLa cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 9 publications below
• IF: See 2 publications below
• ChIP: See 2 publications below
• RIP: See 3 publications below

Product Information

18128-1-AP targets PURB in WB, IF, IP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12705

  Product name: Recombinant human PURB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-312 aa of BC101735

  Sequence: MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED

• Full Name: purine-rich element binding protein B
• Calculated Molecular Weight: 312 aa, 33 kDa
• Observed Molecular Weight: 33-40 kDa
• GenBank Accession Number: BC101735
• Gene Symbol: PURB
• Gene ID (NCBI): 5814
• RRID: AB_2878504
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96QR8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	RIP	Nat Commun; MaTAR25 lncRNA regulates the Tensin1 gene to impact breast cancer progression.; Authors - Kung-Chi Chang
mouse	WB	Mol Metab; Purβ promotes hepatic glucose production by increasing Adcy6 transcription.; Authors - Linna Jia
mouse	WB	Stem Cell Reports; Segregation of the stemness program from the proliferation program in intestinal stem cells; Authors - Yuan Liu
mouse	WB	Int J Mol Sci; Circular Intronic RNA circTTN Inhibits Host Gene Transcription and Myogenesis by Recruiting PURB Proteins to form Heterotypic Complexes; Authors - Nini Ai
bovine	IF,WB	J Cell Physiol; PURB is a positive regulator of amino acid-induced milk synthesis in bovine mammary epithelial cells.; Authors - Nan Huo
mouse	WB,ChIP	J Biol Chem; A novel Cbx1, PurB, and Sp3 complex mediates long-term silencing of tissue- and lineage-specific genes.; Authors - Syeda Samara Baksh