PUS7L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PUS7L Polyclonal antibody, PBS Only (17273-1-PBS)

• 

  WB analysis using 17273-1-AP (same clone as 17273-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17273-1-AP (PUS7L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17273-1-PBS in a different storage buffer formulation.

PUS7L Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17273-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:5.4.99.-, Pseudouridylate synthase 7 homolog-like protein

---

Product Information

17273-1-PBS targets PUS7L in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11030

  Product name: Recombinant human PUS7L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 352-701 aa of BC033621

  Sequence: KVTPERLKNIEKEIEKKRMNVFNIRSVDDSLRLGQLKGNHFDIVIRNLKKQINDSANLRERIMEAIENVKKKGFVNYYGPQRFGKGRKVHTDQIGLALLKNEMMKAIKLFLTPEDLDDPVNRAKKYFLQTEDAKGTLSLMPEFKVRERALLEALHRFGMTEEGCIQAWFSLPHSMRIFYVHAYTSKIWNEAVSYRLETYGARVVQGDLVCLDEDIDDENFPNSKIHLVTEEEGSANMYAIHQVVLPVLGYNIQYPKNKVGQWYHDILSRDGLQTCRFKVPTLKLNIPGCYRQILKHPCNLSYQLMEDHDIDVKTKGSHIDETALSLLISFDLDASCYATVCLKEIMKHDV

• Full Name: pseudouridylate synthase 7 homolog (S. cerevisiae)-like
• Calculated Molecular Weight: 701 aa, 81 kDa
• Observed Molecular Weight: 81, 45 kDa
• GenBank Accession Number: BC033621
• Gene Symbol: PUS7L
• Gene ID (NCBI): 83448
• RRID: AB_3741913
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0K6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.