Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Nectin-2/CD112 Polyclonal antibody

Nectin-2/CD112 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27171-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Nectin-2, Nectin cell adhesion molecule 2, Nectin 2, HVEB, Herpesvirus entry mediator B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat kidney tissue, HAP1 cells, Jurkat cells, mouse kidney tissue, RAW 264.7 cells
Positive IHC detected inhuman tonsillitis tissue, human kidney tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:3000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27171-1-AP targets Nectin-2/CD112 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26040

Product name: Recombinant human Nectin 2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 32-235 aa of BC003091

Sequence: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVT

Predict reactive species
Full Name poliovirus receptor-related 2 (herpesvirus entry mediator B)
Calculated Molecular Weight 58 kDa
Observed Molecular Weight 60-70 kDa
GenBank Accession NumberBC003091
Gene Symbol Nectin-2/CD112
Gene ID (NCBI) 5819
RRIDAB_2880784
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92692
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nectin 2, also named as PVRL2, CD112, HVEB, PRR2 and PVRR2, is an adhesion molecule widely expressed in cell lines of different lineages, including hematopoietic, neuronal, endothelial and epithelial cells. CD112 belongs to a new family of immunoglobulin-like molecules that includes four members (CD111, CD112, PRR3 and CD155) sharing an ectodomain made of three Ig domains, of V and C types. CD112 is expressed in the myelo-monocytic and megakaryocytic hematopoietic lineages and the function in hematopoiesis is currently unknown. CD112 is an intercellular homophilic adhesion. CD112 localizes specifically at adherents junctions via its cytoplasmic interaction with the scaffold F-actin binding protein afadin. Disruption of the murine CD112 gene leads to infertility of male mice with morphologically aberrant spermatozoa. CD112 mediates entry of some alphaherpesvirus mutants (also named HveB) via its V domain. CD112 is involved in cell to cell spreading of viruses.

Protocols

Product Specific Protocols
IHC protocol for Nectin-2/CD112 antibody 27171-1-APDownload protocol
WB protocol for Nectin-2/CD112 antibody 27171-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Mucosal Immunol

Alpha-hemolysin of uropathogenic Escherichia coli induces GM-CSF-mediated acute kidney injury.

Authors - Changying Wang
ratIF

J Transl Int Med

Lipid-related protein NECTIN2 is an important marker in the progression of carotid atherosclerosis: An intersection of clinical and basic studies.

Authors - Shen Li
humanIF

Sci Rep

Single-cell RNA sequencing unveils tumor heterogeneity and immune microenvironment between subungual and plantar melanoma

Authors - Panpan Wang
humanWB,IHC,IF

J Clin Invest

ST6GalNAc-I regulates tumor cell sialylation via NECTIN2/MUC5AC-mediated immunosuppression and angiogenesis in non-small cell lung cancer

Authors - Muthamil Iniyan Appadurai
mouseWB

Environ Int

Mitochondrial ROS-associated integrated stress response is involved in arsenic-induced blood-testis barrier disruption and protective effect of melatonin

Authors - Feng-Wen Niu
humanWB,IHC

Sci Adv

Ara-C suppresses H3 K27-altered spinal cord diffuse midline glioma growth and enhances immune checkpoint blockade sensitivity

Authors - Bo Pang
Loading...
||
New chat

Able

正在加载,请稍候...