PWP1 Polyclonal antibody

• 

  WB analysis of Jurkat using 14767-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14767-1-AP (PWP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 14767-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 14767-1-AP (PWP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 14767-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14767-1-AP (PWP1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

PWP1 Polyclonal Antibody for WB, ELISA

Cat No. 14767-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

IEF SSP 9502, PWP1, PWP1 homolog (S. cerevisiae)

---

Tested Applications

• Positive WB detected in: Jurkat cells, human liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14767-1-AP targets PWP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6533

  Product name: Recombinant human PWP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 154-501 aa of BC001652

  Sequence: CGRAEQDQCNLDVHVYNQEEDSFYVHHDILLSAYPLSVEWLNFDPSPDDSTGNYIAVGNMTPVIEVWDLDIVDSLEPVFTLGSKLSKKKKKKGKKSSSAEGHTDAVLDLSWNKLIRNVLASASADNTVILWDMSLGKPAASLAVHTDKVQTLQFHPFEAQTLISGSYDKSVALYDCRSPDESHRMWRFSGQIERVTWNHFSPCHFLASTDDGFVYNLDARSDKPIFTLNAHNDEISGLDLSSQIKGCLVTASADKYVKIWDILGDRPSLVHSRDMKMGVLFCSSCCPDLPFIYALRGQKEGLRVWDISTVSSVNEAFGRRERLVLGSARNSSISGPFGSRSSDTPMES

• Full Name: PWP1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC001652
• Gene Symbol: PWP1
• Gene ID (NCBI): 11137
• RRID: AB_2174294
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13610
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

H (Verified Customer) (04-05-2020)

There are quite lots of background bands. However, I could detect which is the target band through nuclear-cytosolic fractionation under starvation condition, during which, PWP1 translocate from nucleus to cytosol.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: HEK293T

PWP1 Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:14767-1-AP)