PYGL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PYGL Polyclonal antibody (15851-1-AP)

• Featured Product
• KD/KO Validated

PYGL Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15851-1-AP Copied!

Publications (48)

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Glycogen phosphorylase, liver form, EC:2.4.1.1

• 

  WB analysis using 15851-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15851-1-AP (PYGL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 15851-1-AP

  IP result of anti-PYGL (IP:15851-1-AP, 4ug; Detection:15851-1-AP 1:1000) with mouse liver tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 15851-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15851-1-AP (PYGL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 15851-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15851-1-AP (PYGL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 15851-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15851-1-AP (PYGL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15851-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using PYGL antibody (15851-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PYGL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse liver, rat liver
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human kidney tissue, mouse heart tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15851-1-AP targets PYGL in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, squirrel
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8664

  Product name: Recombinant human PYGL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 499-846 aa of BC009895

  Sequence: GLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN

• Full Name: phosphorylase, glycogen, liver
• Calculated Molecular Weight: 846 aa, 97 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC009895
• Gene Symbol: PYGL
• Gene ID (NCBI): 5836
• RRID: AB_2175014
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06737
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Rabbit anti-PYGL polyclonal antibody (Cat# 15851-1-AP) has 48 citations published in journals including Nature, Nat Med, Cell Metab, Nat Commun, J Clin Invest, Diabetes, EMBO Mol Med, J Biol Chem, and Sci Rep. Research fields span glycogen metabolism, gluconeogenesis, liver disease and regeneration, cancer (HCC, colorectal, pancreatic, lung), diabetes, immune responses, and neuroscience.

Automatically generated from the 48 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Targeting SLC7A11 improves efferocytosis by dendritic cells and wound healing in diabetes.; Authors - Sophia Maschalidi
		Nat Med; PMID: 30150719; Authors - Roger W Hunter
mouse	WB	Cell Metab; Galnt2 neurons in the ventromedial hypothalamus counterregulate hypoglycemia via a brain-liver neurocircuit.; Authors - Junjie Wang
human	WB	Cell Metab; Fibroblasts Mobilize Tumor Cell Glycogen to Promote Proliferation and Metastasis.; Authors - Marion Curtis
human,mouse	WB	Cell Metab; Cell-Intrinsic Glycogen Metabolism Supports Early Glycolytic Reprogramming Required for Dendritic Cell Immune Responses.; Authors - Phyu M Thwe
mouse	WB	Nat Commun; Multi-layered transcriptional control of glycogen metabolism coordinates thermogenic remodeling of white adipocytes in male mice.; Authors - Haipeng Fu

Reviews

5.0 out of 5

2 verified customer reviews

What customers say

Both reviewers rated this antibody 5 stars for Western Blot at a 1:1000 dilution. One user tested it on liver tissue and described it as the best option for Western blot. The other tested it on ovarian cancer samples and reported that it works very well. Overall, users find this antibody reliable and effective for WB applications across different tissue types.

Automatically generated from the 2 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

MALLIKARJUNA (Verified Customer) (11-13-2025)

best to use for Western blot

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: liver tissue

Patricia (Verified Customer) (02-25-2020)

Works very well.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Ovarian cancer