PYROXD2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PYROXD2 Polyclonal antibody, PBS Only (21845-1-PBS)

• 

  WB analysis using 21845-1-AP (same clone as 21845-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21845-1-AP (PYROXD2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21845-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 21845-1-AP (same clone as 21845-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 21845-1-AP (PYROXD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21845-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 21845-1-AP (same clone as 21845-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 21845-1-AP (PYROXD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21845-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 21845-1-AP (same clone as 21845-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21845-1-AP (PYROXD2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21845-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 21845-1-AP (same clone as 21845-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21845-1-AP (PYROXD2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21845-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 21845-1-AP (same clone as 21845-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using PYROXD2 antibody (21845-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 21845-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 21845-1-AP (same clone as 21845-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using PYROXD2 antibody (21845-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21845-1-PBS in a different storage buffer formulation.

PYROXD2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21845-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C10orf33, FP3420, YueF

---

Product Information

21845-1-PBS targets PYROXD2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15004

  Product name: Recombinant human C10orf33 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 232-581 aa of BC006131

  Sequence: DQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLKLTPQEWLPEEFLERISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGQPLPHHQCSIHLNCEDTLLLHQAFEDAMDGLSSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYTPYTLAGGKAWDEQERDAYADRVFDCIEVYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHSGYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVAFRDLKSM

• Full Name: chromosome 10 open reading frame 33
• Calculated Molecular Weight: 581 aa, 63 kDa
• Observed Molecular Weight: 63 kDa
• GenBank Accession Number: BC006131
• Gene Symbol: PYROXD2
• Gene ID (NCBI): 84795
• RRID: AB_3669377
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N2H3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Pyridine Nucleotide-Disulfide Oxidoreductase Domain 2 (PYROXD2, previously called YueF, C10orf33) is a mitochondrial inner membrane/matrix-residing protein and is reported to regulate mitochondrial function. PYROXD2 is highly expressed in the cytoplasm of normal cells and tissues but is expressed at lower levels in corresponding cancer cells, including liver, lung and renal cell carcinoma and bladder cancer cells (PMID: 29048625, PMID: 35606887).