Pregnancy Zone Protein Polyclonal antibody

• 

  WB analysis using 21742-1-AP

  Human plasma were subjected to SDS PAGE followed by western blot with 21742-1-AP (pregnancy zone protein antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 21742-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 21742-1-AP (pregnancy zone protein antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 21742-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21742-1-AP (Pregnancy Zone Protein antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 21742-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21742-1-AP (Pregnancy Zone Protein antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 21742-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 21742-1-AP (pregnancy zone protein antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 21742-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 21742-1-AP (pregnancy zone protein antibody) at dilution of 1:50 (under 40x lens).

Pregnancy Zone Protein Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21742-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

PZP, pregnancy-zone protein

---

Tested Applications

• Positive WB detected in: human plasma, human placenta tissue
• Positive IHC detected in: human placenta tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

21742-1-AP targets Pregnancy Zone Protein in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16471

  Product name: Recombinant human PZP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-690 aa of BC111756

  Sequence: ITAHYTLNRQAMGELSELSFHYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFAILPDGEVVGDSEKFEIENCLANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSVLLMKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVL

• Full Name: pregnancy-zone protein
• Calculated Molecular Weight: 1482 aa, 164 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC111756
• Gene Symbol: Pregnancy Zone Protein
• Gene ID (NCBI): 5858
• RRID: AB_10732823
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20742
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pregnancy Zone Protein (PZP) is an immunosuppressive protein that is expressed by the placenta. The PZP is a thiol ester-containing alpha macroglobulin protein that controls the proteolytic pathways during pregnancy and contributes to maintaining the immunologically privileged status of the fetus. Recently PZP over-expression has been described as a novel biomarker for predicting the prognosis of hepatocellular carcinoma and its high expression has been reported in solid tumors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Clin Proteomics; iTRAQ plasma proteomics analysis for candidate biomarkers of type 2 incipient diabetic nephropathy.; Authors - Hongmei Lu
	WB,IHC,IF	Stem Cells Transl Med; Mesenchymal stromal cells-derived small extracellular vesicles protect against UV-induced photoaging via regulating pregnancy zone protein; Authors - Zixuan Sun
human	WB	J Gene Med; Integrated Single-Cell Transcriptome and eQTL Analyses Reveal the Role of PZP in Aging and Chronic Kidney Disease; Authors - Xinhui Huang