• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Palladin Polyclonal antibody

Palladin Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-10853

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

PALLD, PALLD,palladin, CGI 151, CGI-151, KIAA0992

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL488-10853 targets Palladin in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1288

Product name: Recombinant human PALLD,palladin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 127-510 aa of BC013867

Sequence: APFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL

Predict reactive species
Full Name palladin, cytoskeletal associated protein
Calculated Molecular Weight 1383 aa, 151 kDa
Observed Molecular Weight
GenBank Accession NumberBC013867
Gene Symbol palladin
Gene ID (NCBI) 23022
RRIDAB_2919005
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WX93
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Palladin is an actin associated protein serving as a cytoskeleton scaffold, and actin cross linker, localizing at stress fibers, focal adhesions, and other actin based structures. Palladin exists as multiple isoforms through alternative transcription initiation sites and splicing. There are three major isoforms (200, 140, 90-92 kDa) and multiple minor isoforms. Different palladin isoforms are expressed in a tissue-specific pattern during development and in adult organs: the 200 kDa isoform is predominantly expressed in the heart, skeletal muscle, testis and bone; the 140 kDa isoform is widely expressed with the exception of liver, muscle, and skin; the 90-92 kDa isoform is broadly expressed in embryonic tissues and highly expressed in adult smooth muscle tissues (21455759). Recently overexpression of palladin has been linked to the promoted invasive motility in several types of cancers (18978809, 22291919). The 85-90 kDa palladin isoform has been observed predominantly expressed in pancreatic ductal adenocarcinoma (PDA) while a 65 kDa isoform is expressed in normal pancreas and non-PDA tumors (20436683). This antibody, generated against the fragment 999-1383aa of palladin, recognizes most isoforms of this protein, except isoform 6.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Palladin antibody CL488-10853Download protocol
IF protocol for CL Plus 488 Palladin antibody CL488-10853Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cytoskeleton (Hoboken)

Overexpressed Palladin Rescues Enteropathogenic E. coli (EPEC) Pedestal Lengths in ArpC2 Depleted Cells

Authors - Kaitlin M Bruzzini
Loading...
||
New chat

Able

正在加载,请稍候...