PARK2/Parkin Recombinant monoclonal antibody

• 

  Affinity and Kinetic Characterization of 83224-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83224-2-RR against Human PARK2/Parkin were performed. The affinity constant is 89.4 pM.

PARK2/Parkin Uni-rAb^® Recombinant Antibody for ELISA

Cat No. 83224-2-RR

Clone No.240077C12

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

ELISA

Synonyms

AR JP, LPRS2, PARK2, Parkinson disease protein 2, PDJ, PRKN

---

Product Information

83224-2-RR targets PARK2/Parkin in ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5179

  Product name: Recombinant human Parkin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 81-387 aa of BC022014

  Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK

• Full Name: Parkinson disease (autosomal recessive, juvenile) 2, parkin
• Calculated Molecular Weight: 52 kDa
• GenBank Accession Number: BC022014
• Gene Symbol: Parkin
• Gene ID (NCBI): 5071
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60260
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.