PARK2/Parkin Recombinant monoclonal antibody

• 

  WB analysis using 83224-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83224-5-RR (Parkin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

PARK2/Parkin Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83224-5-RR

Clone No.252526H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

PARK2, Parkin, E3 ubiquitin-protein ligase parkin, EC:2.3.2.31, Parkin RBR E3 ubiquitin-protein ligase

---

Tested Applications

• Positive WB detected in: HEK-293T cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83224-5-RR targets PARK2/Parkin in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5092

  Product name: Recombinant human Parkin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 81-387 aa of BC022014

  Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK

• Full Name: Parkinson disease (autosomal recessive, juvenile) 2, parkin
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC022014
• Gene Symbol: Parkin
• Gene ID (NCBI): 5071
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60260
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a variety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease.