Perforin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Perforin Recombinant monoclonal antibody, PBS Only (83977-1-PBS)

Perforin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 83977-1-PBS

Clone No.241009C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

241009C10, Cytolysin, FLH2, HPLH2, Lymphocyte pore-forming protein

• 

  WB analysis using 83977-1-RR (same clone as 83977-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83977-1-RR (Perforin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83977-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of Human PBMC using 83977-1-RR (same clone as 83977-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human PBMC using Perforin antibody (83977-1-RR, Clone: 241009C10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83977-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of CTLL-2 using 83977-1-RR (same clone as 83977-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed CTLL-2 cells using Perforin antibody (83977-1-RR, Clone: 241009C10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83977-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 83977-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83977-1-PBS against Human Perforin was performed. The affinity constant is 1.33 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 83977-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83977-1-RR against Human Perforin were performed. The affinity constant is 1.05 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

83977-1-PBS targets Perforin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6060

  Product name: Recombinant human Perforin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 247-555 aa of BC063043

  Sequence: EGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW

• Full Name: perforin 1 (pore forming protein)
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC063043
• Gene Symbol: Perforin
• Gene ID (NCBI): 5551
• RRID: AB_3671552
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14222
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Perforin (PRF1) is one of the major cytolytic proteins of cytolytic granules. It is known to be a crucial effector molecule in cytolytic T lymphocyte and natural killer cell-mediated cytotoxicity. This protein has structural and functional similarities to complement component C9. Like C9, this protein creates transmembrane tubules and is capable of lysing nonspecifically a variety of target cells. Defects in PRF1 are the cause of familial hemophagocytic lymphohistiocytosis type 2 (FHL2), which is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. (PMID: 2417226; 7774276; 2783486; 10583959)