Perforin Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 83977-1-RR (same clone as 83977-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83977-1-RR (Perforin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83977-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00872-1

  Cytometric bead array standard curve of MP00872-1, Perforin Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83977-2-PBS. Detection antibody: 83977-1-PBS. Standard: Ag6060. Range: 0.781-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 83977-1-PBS

  Biolayer interferometry (BLl) kinetic assay of 83977-1-PBS against Human Perforin was performed. The affinity constant is 1.33 nM.

• 

  Affinity and Kinetic Characterization of 83977-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83977-1-RR against Human Perforin were performed. The affinity constant is 1.05 nM.

Perforin Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83977-1-PBS

Clone No.241009C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

241009C10, Cytolysin, FLH2, HPLH2, Lymphocyte pore-forming protein

---

Product Information

83977-1-PBS targets Perforin as part of a matched antibody pair:

MP00872-1: 83977-2-PBS capture and 83977-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6060

  Product name: Recombinant human Perforin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 247-555 aa of BC063043

  Sequence: EGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW

• Full Name: perforin 1 (pore forming protein)
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC063043
• Gene Symbol: Perforin
• Gene ID (NCBI): 5551
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14222
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Perforin (PRF1) is one of the major cytolytic proteins of cytolytic granules. It is known to be a crucial effector molecule in cytolytic T lymphocyte and natural killer cell-mediated cytotoxicity. This protein has structural and functional similarities to complement component C9. Like C9, this protein creates transmembrane tubules and is capable of lysing nonspecifically a variety of target cells. Defects in PRF1 are the cause of familial hemophagocytic lymphohistiocytosis type 2 (FHL2), which is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. (PMID: 2417226; 7774276; 2783486; 10583959)