Phosducin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Phosducin Polyclonal antibody, PBS Only (33132-1-PBS)

• 

  WB analysis using 33132-1-AP (same clone as 33132-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33132-1-AP (PDC antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33132-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse eye using 33132-1-AP (same clone as 33132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 33132-1-AP (Phosducin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33132-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse eye using 33132-1-AP (same clone as 33132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 33132-1-AP (Phosducin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33132-1-PBS in a different storage buffer formulation.

Phosducin Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 33132-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

33 kDa phototransducing protein, PDC, PHD, Protein MEKA

---

Product Information

33132-1-PBS targets Phosducin in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37137

  Product name: Recombinant human PDC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-140 aa of NM_002597.4

  Sequence: KFKLESQDSDSIPPSKKEILRQMSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETGKQFLETIEKELKITTIVVHI

• Full Name: phosducin
• Calculated Molecular Weight: 28 kDa, 246 aa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: NM_002597.4
• Gene Symbol: PDC
• Gene ID (NCBI): 5132
• RRID: AB_3742864
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P20941
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phosducin/PDC, which tightly binds betagamma-subunits of heterotrimeric G-proteins, has been conjectured to play a role in regulating second messenger signaling cascades. Phosducin may act as a phosphorylation-dependent switch in second messenger signaling cascades, regulating the kinetics of desensitization processes by controlling the activity of Gbetagamma-dependent GRKs (PMID: 9020189).