Placental lactogen Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Placental lactogen Polyclonal antibody, PBS Only (16326-1-PBS)

• 

  WB analysis using 16326-1-AP (same clone as 16326-1-PBS)

  Human placenta tissue were subjected to SDS PAGE followed by western blot with 16326-1-AP (Placental lactogen antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16326-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 16326-1-AP (same clone as 16326-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 16326-1-AP (Placental lactogen antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16326-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human colon using 16326-1-AP (same clone as 16326-1-PBS)

  human colon tissue were subjected to SDS PAGE followed by western blot with 16326-1-AP (Placental lactogen antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 16326-1-AP (same clone as 16326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16326-1-AP (Placental lactogen antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 16326-1-AP (same clone as 16326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16326-1-AP (Placental lactogen antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 16326-1-AP (same clone as 16326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16326-1-AP (Placental lactogen antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16326-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 16326-1-AP (same clone as 16326-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16326-1-AP (Placental lactogen antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16326-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 16326-1-AP (same clone as 16326-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Placental lactogen antibody (16326-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16326-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 16326-1-AP (same clone as 16326-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Placental lactogen antibody (16326-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16326-1-PBS in a different storage buffer formulation.

Placental lactogen Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 16326-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CSH2, Choriomammotropin, CS 2, CSB, CSH1

---

Product Information

16326-1-PBS targets Placental lactogen in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9412

  Product name: Recombinant human CSH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC022044

  Sequence: MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

• Full Name: chorionic somatomammotropin hormone 2
• Calculated Molecular Weight: 217 aa, 25 kDa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: BC022044
• Gene Symbol: CSH2
• Gene ID (NCBI): 1443
• RRID: AB_2083883
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01243
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The human growth hormone (GH) locus is comprised by two GH (GH1 and GH2) genes and three chorionic somatomammotropin (CSH1, CSH2 and CSH-L) genes. Placental lactogens (CSH1, CSH2) are produced in the mammalian placenta and are similar in structure and function to growth hormones. Together, placental lactogens and growth factors play an essential role to assure successful lactation after pregnancy. Placental lactogens also modify the metabolic state of the mother during pregnancy to supply energy to the fetus.