Placental lactogen Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 86658-1-RR (same clone as 86658-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 86658-1-RR (CSH2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86658-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 86658-1-RR (same clone as 86658-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 86658-1-RR (Placental lactogen antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86658-1-PBS in a different storage buffer formulation.

Placental lactogen Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86658-1-PBS

Clone No.251639A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CSH2, Choriomammotropin, CS 2, CSB, CSH1

---

Product Information

86658-1-PBS targets Placental lactogen in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9412

  Product name: Recombinant human CSH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC022044

  Sequence: MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

• Full Name: chorionic somatomammotropin hormone 2
• Calculated Molecular Weight: 217 aa, 25 kDa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: BC022044
• Gene Symbol: CSH2
• Gene ID (NCBI): 1443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01243
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The human growth hormone (GH) locus is comprised by two GH (GH1 and GH2) genes and three chorionic somatomammotropin (CSH1, CSH2 and CSH-L) genes. Placental lactogens (CSH1, CSH2) are produced in the mammalian placenta and are similar in structure and function to growth hormones. Together, placental lactogens and growth factors play an essential role to assure successful lactation after pregnancy. Placental lactogens also modify the metabolic state of the mother during pregnancy to supply energy to the fetus.