CoraLite® Plus 488-conjugated Podocalyxin Monoclonal antibody

Podocalyxin Monoclonal Antibody for
Cat No. CL488-68250
Clone No.4A3C7

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

PODXL, 4A3C7, GCTM 2 antigen, GCTM-2 antigen, Gp200

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-68250 targets Podocalyxin in applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12859

Product name: Recombinant human TRA-1-60 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 23-428 aa of BC093730

Sequence: SPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSM

Predict reactive species
Full Name podocalyxin-like
Calculated Molecular Weight 526 aa, 55 kDa
Observed Molecular Weight60-70 kDa
GenBank Accession NumberBC093730
Gene Symbol Podocalyxin
Gene ID (NCBI) 5420
RRIDAB_3084456
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00592
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Podocalyxin, also known as podocalyxin-like protein 1 (PODXL or PCLP1), is a transmembrane glycoprotein belonging to the CD34 family of sialomucins. Podocalyxin was originally identified as the major sialoprotein on podocytes of the kidney glomerulus, but was later found to be expressed on vascular endothelial cells and early hematopoietic progenitors. It Involved in the regulation of both adhesion and cell morphology. In addition, podocalyxin is highly expressed in embryonic stem cells and aberrant expression of podocalyxin has been implicated in a wide range of cancers. Podocalyxin is a protein with a peptide bone of ∼55.5 kDa that undergoes a post‐translational glycosylation, the different molecular mass of podocalyxin indicates the extent and variability of glycosylation patterns (PMID: 17092254).

Loading...
||
New chat

Able

正在加载,请稍候...