Podoplanin Monoclonal antibody, PBS Only (Detector)

Podoplanin Monoclonal Antibody for IHC, IF-P, FC, Cytometric bead array, Indirect ELISA
Cat No. 67432-1-PBS
Clone No.1D9F3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IHC, IF-P, FC, Cytometric bead array, Indirect ELISA

PDPN, 1D9F3, 29kDa cytosolic podoplanin intracellular domain, Aggrus, PA2.26 antigen

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67432-1-PBS targets Podoplanin as part of a matched antibody pair:

MP50340-1: 67432-2-PBS capture and 67432-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17691

Product name: Recombinant human PDPN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 101-238 aa of BC022812

Sequence: TGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGGIIVVVMRKMSGRYSP

Predict reactive species
Full Name podoplanin
Calculated Molecular Weight 238 aa, 25 kDa
GenBank Accession NumberBC022812
Gene Symbol Podoplanin
Gene ID (NCBI) 10630
RRIDAB_2882670
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ86YL7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Podoplanin was identified as a glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels. The antibody is specific to Podoplanin.

Loading...
||
New chat Able
正在加载,请稍候...