Mouse Pon3 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP02543-1

  The mean PON3 concentration was determined to be 41.6 ng/mL in RAW 264.7 cell extract based on a 1.3 mg/mL extract load and 1,033.8 ng/mL in mouse liver tissue extract based on a 8.4 mg/mL extract load.

• 

  Sandwich ELISA sample test of MP02543-1

  Serum of six mice was measured. The PON3 concentration of detected samples was determined to be 19.6 ng/mL with a range of 16.7-21.2 ng/mL.

• 

  Sandwich ELISA standard curve of MP02543-1

  Sandwich ELISA standard curve of MP02543-1, Mouse PON3 Recombinant Matched Antibody Pair - PBS only. 86577-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2743. 86577-1-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL.

• 

  Cytometric bead array sample test of MP02543-1

  The mean PON3 concentration was determined to be 986.3 ng/mL in Mouse liver tissue extract based on a 8.4 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02543-1

  Cytometric bead array standard curve of MP02543-1, MOUSE PON3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86577-2-PBS. Detection antibody: 86577-1-PBS. Standard: Eg2743. Range: 0.469-60 ng/mL.

Pon3 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86577-2-PBS

Clone No.251535A2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

EC:3.1.8.1, Paraoxanase-3, Serum paraoxonase/lactonase 3

---

Product Information

86577-2-PBS targets Pon3 as part of a matched antibody pair:

MP02543-1: 86577-2-PBS capture and 86577-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2743

  Product name: Recombinant Mouse Pon3 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-354 aa of NM_173006.1

  Sequence: RLLNFRERVSTTREIKATEPQNCHLIEGLENGSEDIDILPSGLAFISTGLKYPGMPAFAPDKPGRIFLMDLNEQNPEAQALEISGGLDQESLNPHGISTFIDKDNTAYLYVVNHPNMDSTVEIFKFEEQQRSLIHLKTLKHELLKSVNDIVVLGPEQFYATRDHYFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSANGITVSLDQKFVYVADVTAKNIHIMKKHDNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVLRIQDSLSDKPRVSTLYANNGSVLQGSTVASVYHKRMLIGTIFHKALYCDL

• Full Name: paraoxonase 3
• Calculated Molecular Weight: 39 kDa
• GenBank Accession Number: NM_173006.1
• Gene Symbol: Pon3
• Gene ID (NCBI): 269823
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q62087
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.