Tested Applications
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
33907-1-AP targets Prm2 in IHC, IF-P, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag39746 Product name: Recombinant mouse Prm2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC049612 Sequence: MVRYRMRSPSEGPHQGPGQDHEREEQGQGQGLSPERVEDYGRTHRGHHHHRHRRCSRKRLHRIHKRRRSCRRRRRHSCRHRRRHRRGCRRSRRRRRCRCRKCRRHHH Predict reactive species |
| Full Name | protamine 2 |
| GenBank Accession Number | BC049612 |
| Gene Symbol | Prm2 |
| Gene ID (NCBI) | 19119 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P07978 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Prm2 antibody 33907-1-AP | Download protocol |
| IHC protocol for Prm2 antibody 33907-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





