Prm2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Prm2 Polyclonal antibody (33907-1-AP)

• 

  IHC staining of mouse testis using 33907-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 33907-1-AP (Prm2 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 33907-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 33907-1-AP (Prm2 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 33907-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using Prm2 antibody (33907-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Prm2 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 33907-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IHC, IF-P, ELISA

Synonyms

---

Tested Applications

• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33907-1-AP targets Prm2 in IHC, IF-P, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39746

  Product name: Recombinant mouse Prm2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-107 aa of BC049612

  Sequence: MVRYRMRSPSEGPHQGPGQDHEREEQGQGQGLSPERVEDYGRTHRGHHHHRHRRCSRKRLHRIHKRRRSCRRRRRHSCRHRRRHRRGCRRSRRRRRCRCRKCRRHHH

• Full Name: protamine 2
• GenBank Accession Number: BC049612
• Gene Symbol: Prm2
• Gene ID (NCBI): 19119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P07978
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.