Prnd Polyclonal antibody

• 

  WB analysis of human skeletal muscle using 51026-2-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 51026-2-AP (Prnd antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Prnd Polyclonal Antibody for WB, ELISA

Cat No. 51026-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

AI450264, doppel, Dpl, prion protein dublet, Prnd, PrPLP

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

51026-2-AP targets Prnd in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0731

  Product name: Recombinant mouse Prnd protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-154 aa of BC025140

  Sequence: RGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLER

• Full Name: prion protein dublet
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC025140
• Gene Symbol: Prnd
• Gene ID (NCBI): 26434
• RRID: AB_615020
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9QUG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.