Proenkephalin-A Polyclonal antibody

Proenkephalin-A Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 32272-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

PENK, Proenkephalin A, Opioid growth factor, Met-enkephalin-Arg-Phe, Met-enkephalin-Arg-Gly-Leu

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue, mouse brain tissue, human heart tissue, rat brain tissue
Positive IHC detected inmouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

32272-1-AP targets Proenkephalin-A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27972

Product name: Recombinant human PENK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 100-267 aa of BC032505

Sequence: YGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF

Predict reactive species
Full Name proenkephalin
Calculated Molecular Weight 267 aa, 31 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC032505
Gene Symbol Proenkephalin A
Gene ID (NCBI) 5179
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP01210
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proenkephalin-A (PENK) is also named as Synenkephalin, Met-enkephalin and Opioid growth factor (OGF), and belongs to the opioid neuropeptide precursor family. PENK is a neuropeptide that competes with and mimics the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress (PMID:7057924). PENK hypermethylation is also associated with bladder cancer, hepatocellular carcinoma, colorectal cancer, and prostate cancer (PMID:36403035). Proenkephalin (PENK) represents a new candidate to determine kidney function. This peptide is cleaved from the precursor peptide preproenkephalin A alongside enkephalins (endogenous opioids) and is filtrated in the glomerulus (PMID: 33636859).

Protocols

Product Specific Protocols
IF protocol for Proenkephalin-A antibody 32272-1-APDownload protocol
IHC protocol for Proenkephalin-A antibody 32272-1-APDownload protocol
WB protocol for Proenkephalin-A antibody 32272-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...