Profilin 1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Profilin 1 Recombinant monoclonal antibody (88038-1-RR)

Profilin 1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88038-1-RR

Clone No.260024B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PFN1, ALS18, PFN 1, Profilin I, profilin1

• 

  WB analysis using 88038-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88038-1-RR (Profilin 1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88038-1-RR targets Profilin 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2286

  Product name: Recombinant human PFN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-140 aa of BC006768

  Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

• Full Name: profilin 1
• Calculated Molecular Weight: 140 aa, 15 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC006768
• Gene Symbol: Profilin 1
• Gene ID (NCBI): 5216
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07737
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Profilin-1 (PFN1) plays an important role in the control of actin dynamics, and could represent an important therapeutic target in several diseases. PFN1 is identified as a huntingtin aggregation inhibitor, and may serves as a tumor-suppressor. PFN1 is crucial for the conversion of monomeric (G)-actin to filamentous (F)-actin. Amyotrophic lateral sclerosis (ALS) is a late-onset neurodegenerative disorder resulting from motor neuron death. Cells expressing PFN1 mutants contain ubiquitinated, insoluble aggregates that in many cases contain the ALS-associated protein TDP-43. Recently, PFN1 is a potential biomarker for bladder cancer aggressiveness and may be of great clinical importance.