Prohibitin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Prohibitin Recombinant monoclonal antibody, PBS Only (88442-1-PBS)

Prohibitin Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 88442-1-PBS

Clone No.260999D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PHB, PHB1, Prohibitin 1

• 

  WB analysis using 88442-1-RR (same clone as 88442-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88442-1-RR (Prohibitin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88442-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 88442-1-RR (same clone as 88442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 88442-1-RR (Prohibitin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88442-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 88442-1-RR (same clone as 88442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 88442-1-RR (Prohibitin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88442-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 88442-1-RR (same clone as 88442-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 88442-1-RR (Prohibitin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88442-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 88442-1-RR (same clone as 88442-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Prohibitin antibody (88442-1-RR, Clone: 260999D9 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 88442-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88442-1-PBS targets Prohibitin in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1240

  Product name: Recombinant human Prohibitin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-272 aa of BC013401

  Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

• Full Name: prohibitin
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC013401
• Gene Symbol: Prohibitin
• Gene ID (NCBI): 5245
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35232
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Prohibitin, also known as PHB, a member of the Band-7 family of proteins, is widely distributed in bacteria, plants, yeast, protozoa and mammals and is important in cell proliferation, differentiation and apoptosis (PMID: 20840588 ). This protein localizes to the inner membrane of mitochondria, where it acts as a chaperone protein, and is also found in the nucleus, where it negatively regulates transcription (PMID: 18558096). Recent study confirmed that the expression and distribution of PHB, which is a nuclear matrix protein, affect the apoptosis of HaCaT cells and its co-localization with specific gene products connected with cell apoptosis (PMID: 24402549).