QRICH1 Polyclonal antibody

• 

  WB analysis using 30236-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30236-1-AP (QRICH1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 30236-1-AP

  WB result of QRICH1 antibody (30236-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-QRICH1 transfected Jurkat cells.

• 

  WB analysis using 30236-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30236-1-AP (QRICH1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 30236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 30236-1-AP (QRICH1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 30236-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using QRICH1 antibody (30236-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

QRICH1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30236-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Transcriptional regulator QRICH1, Glutamine-rich protein 1, Glutamine rich protein 1, glutamine rich 1

---

Tested Applications

• Positive WB detected in: HEK-293T cells, Jurkat cells, NIH/3T3 cells
• Positive IHC detected in: mouse testis tissue, rat brain tissue, human colon cancer tissue, human lung cancer tissue, mouse brain tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30236-1-AP targets QRICH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31997

  Product name: Recombinant human QRICH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC110855

  Sequence: MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGNCIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQLSPQLTVHQPTEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQIQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTASVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATGT

• Full Name: glutamine-rich 1
• Observed Molecular Weight: 85-110 kDa
• GenBank Accession Number: BC110855
• Gene Symbol: QRICH1
• Gene ID (NCBI): 54870
• RRID: AB_3086273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2TAL8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glutamine-rich protein 1 (QRICH1) is a transcriptional regulator that acts as a mediator of the integrated stress response (ISR) through transcriptional control of protein homeostasis under conditions of ER stress (PMID:33384352). QRICH1 is a member of the caspase recruitment domain (CARD)-containing gene family, which encodes for proteins implicated in regulation of caspase activation in the context of apoptosis and inflammation, and in regulation of NF-κB signaling(PMID:33384352). QRICH1 can be modified by phosphorylation.