RAB11FIP5 Recombinant monoclonal antibody

• 

  WB analysis using 83939-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83939-2-RR (RAB11FIP5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83939-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83939-2-RR against Human RAB11FIP5 were performed. The affinity constant is below 1 pM.

RAB11FIP5 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83939-2-RR

Clone No.241038E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

241038E11, GAF1, Gaf-1, Gamma-SNAP-associated factor 1, Rab11 family-interacting protein 5

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83939-2-RR targets RAB11FIP5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6128

  Product name: Recombinant human RAB11FIP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-250 aa of BC035013

  Sequence: MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRAQHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSAMFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASAILPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLTQSNTS

• Full Name: RAB11 family interacting protein 5 (class I)
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC035013
• Gene Symbol: RAB11FIP5
• Gene ID (NCBI): 26056
• RRID: AB_3671520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BXF6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rab11 family-interacting protein 5 (Rab11fip5) is an adaptor protein that binds to the small GTPase Rab11, which has an important function in endosome recycling and trafficking of cellular proteins to the plasma membrane. Rab11fip5 is involved in many cellular processes, such as cytoskeleton rearrangement, iron uptake and exocytosis in neuroendocrine cells, and is also known as a candidate gene for autism-spectrum disorder.