RAB12 Polyclonal antibody

• 

  WB analysis using 29927-1-AP

  Human brain tissue was subjected to SDS PAGE followed by western blot with 29927-1-AP (RAB12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29927-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29927-1-AP (RAB12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 29927-1-AP

  IP result of anti-RAB12 (IP:29927-1-AP, 4ug; Detection:29927-1-AP 1:1500) with mouse brain tissue lysate 2100 ug.

RAB12 Polyclonal Antibody for WB, IP, ELISA

Cat No. 29927-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

Ras-related protein Rab-12, Ras related protein Rab 12

---

Tested Applications

• Positive WB detected in: human brain tissue, mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29927-1-AP targets RAB12 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31627

  Product name: Recombinant human RAB12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 105-244 aa of NM_001025300

  Sequence: NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

• Full Name: RAB12, member RAS oncogene family
• Calculated Molecular Weight: 27KD
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: NM_001025300
• Gene Symbol: RAB12
• Gene ID (NCBI): 201475
• RRID: AB_3669700
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IQ22
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rab12, a previously uncharacterized Rab isoform, is mainly localized at TfR-positive recycling endosomes and is specifically involved in TfR degradation. Rab12 is a regulator of LRRK2 and its activation by damaged lysosomes.