RAB14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAB14 Polyclonal antibody (15662-1-AP)

• Featured Product
• KD/KO Validated

RAB14 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15662-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

EC:3.6.5.2, FBP, RAB 14, Ras related protein Rab 14, Ras-related protein Rab-14

• 

  WB analysis of mouse brain using 15662-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15662-1-AP (RAB14 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 15662-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15662-1-AP (RAB14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 15662-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15662-1-AP (RAB14 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 15662-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15662-1-AP (RAB14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 15662-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15662-1-AP (RAB14 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 15662-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 15662-1-AP (RAB14 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 15662-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 15662-1-AP (RAB14 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 15662-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 15662-1-AP (RAB14 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAB14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, HepG2 cells, human brain tissue, mouse kidney tissue, Raji cells, rat brain tissue
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15662-1-AP targets RAB14 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8092

  Product name: Recombinant human RAB14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC006081

  Sequence: MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC

• Full Name: RAB14, member RAS oncogene family
• Calculated Molecular Weight: 215 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC006081
• Gene Symbol: RAB14
• Gene ID (NCBI): 51552
• RRID: AB_2173630
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61106
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB14, the final member of the Rab11 subfamily, participates in the regulation of cell secretion, ensuring the timely release of necessary substances outside the cell. RAB14 is ubiquitously expressed and localizes to the Golgi/TGN and at early endosomes (PMID: 16962593, 22595670). RAB14 contains 215 amino acids, with a molecular weight of approximately 24.6 kDa

Publications

What published studies show

RAB14 antibody (Cat# 15662-1-AP) has 14 citations published in journals including Nature Communications, Acta Pharmaceutica Sinica B, Journal of Experimental & Clinical Cancer Research, FASEB Journal, BMC Cancer, Journal of Virology, Journal of Gene Medicine, Virchows Archiv, Tumour Biology, PLoS One, European Review for Medical and Pharmacological Sciences, Cell Physiology and Biochemistry, and Onco Targets and Therapy. Research fields span oncology (lung, gastric, ovarian, pancreatic, esophageal, cervical, colorectal, nasopharyngeal cancers), virology, and cell signaling.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; Interruption of post-Golgi STING trafficking activates tonic interferon signaling; Authors - Xintao Tu ; KO Validated
mouse	WB	Acta Pharm Sin B; A rationally designed CD19 monoclonal antibody-triptolide conjugate for the treatment of systemic lupus erythematosus; Authors - Lai Wang
human	WB	J Exp Clin Cancer Res; Circular RNA hsa_circ_0000326 acts as a miR-338-3p sponge to facilitate lung adenocarcinoma progression.; Authors - Yuzhu Xu
mouse	WB,IF	FASEB J; Rab14-Mediated Lipophagy Disrupts Lipid Homeostasis in Granulosa Cells and Impairs Female Fertility.; Authors - Dan Zhong
human	WB,IHC	BMC Cancer; MiR-214-3p targets Ras-related protein 14 (RAB14) to inhibit cellular migration and invasion in esophageal Cancer cells; Authors - Pornima Phatak
pig	WB,IF	J Virol; The Small GTPase Rab14 Regulates the Trafficking of Ceramide from Endoplasmic Reticulum to Golgi Apparatus and Facilitates Classical Swine Fever Virus Assembly; Authors - Ya-Yun Liu ; KD Validated