Rab18 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Rab18 Polyclonal antibody (11304-1-AP)

• Featured Product
• KD/KO Validated

Rab18 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 11304-1-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

Synonyms

RAB18LI1, Ras related protein Rab 18, Ras-related protein Rab-18

• 

  WB analysis using 11304-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11304-1-AP (Rab18 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 11304-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 11304-1-AP (RAB18 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 11304-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11304-1-AP (RAB18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 11304-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11304-1-AP (RAB18 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 11304-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 11304-1-AP (RAB18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 11304-1-AP

  IP result of anti-Rab18 (IP:11304-1-AP, 4ug; Detection:11304-1-AP 1:2000) with mouse testis tissue lysate 1120 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of rat testis using 11304-1-AP

  IP result of anti-Rab18 (IP:11304-1-AP, 4ug; Detection:11304-1-AP 1:2000) with rat testis tissue lysate 4000 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 11304-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11304-1-AP (Rab18 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 11304-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11304-1-AP (Rab18 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 11304-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11304-1-AP (Rab18 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 11304-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11304-1-AP (Rab18 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 11304-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Rab18 antibody (11304-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 11304-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Rab18 antibody (11304-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 11304-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using Rab18 antibody (11304-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Rab18 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat brain tissue, human brain tissue, human heart tissue, human testis tissue, PC-3 cells, mouse brain tissue, mouse testis tissue
• Positive IP detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: human stomach cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11304-1-AP targets Rab18 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1841

  Product name: Recombinant human RAB18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC015014

  Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL

• Full Name: RAB18, member RAS oncogene family
• Calculated Molecular Weight: 206 aa, 23 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC015014
• Gene Symbol: RAB18
• Gene ID (NCBI): 22931
• RRID: AB_2173932
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP72
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB18 is a member of a family of Ras-related small GTPases. RAB18 plays a role in apical endocytosis/recycling, and may be implicated in transport between the plasma membrane and early endosomes. It also plays a key role in eye and brain development and neurodegeneration. Defects in RAB18 are associated with Warburg micro syndrome type 3.

Publications

What published studies show

The RAB18 antibody (Cat# 11304-1-AP) has 21 citations across journals including Autophagy, J Clin Invest, Advanced Science, Developmental Cell, Journal of Cell Biology, PLoS Pathogens, BMC Cancer, and Onco Targets Therapy. Research fields span lipid metabolism, lipophagy, autophagy, cancer biology (lung, gastric, head and neck, hepatoma), neurology (spastic paraplegia, Warburg Micro Syndrome), virology (HCV, HBV), hepatic fibrosis, and circadian rhythm regulation.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Autophagy; RAB18-dependent recruitment of OPTN initiates selective lipophagy in osteoblasts.; Authors - Chonghao Ji
human	WB,IF	J Clin Invest; RINT1 deficiency disrupts lipid metabolism and underlies a complex hereditary spastic paraplegia; Authors - Nathalie Launay
mouse,human	WB,IHC,IF,CoIP	Adv Sci (Weinh); Diallyl Trisulfide From Garlic Regulates RAB18 Phase Separation to Inhibit Lipophagy and Induce Cuproptosis in Hepatic Stellate Cells for Antifibrotic Effects; Authors - Haoyuan Tian ; KD Validated
mouse	WB	Food Chem; Pu-erh tea increases the metabolite Cinnabarinic acid to improve circadian rhythm disorder-induced obesity.; Authors - Shanshan Hu
mouse	IF	Dev Cell; KIF3B promotes a PI3K signaling gradient causing changes in a Shh protein gradient and suppressing polydactyly in mice; Authors - Shuo Wang
monkey	WB	J Cell Biol; Rab18 and a Rab18 GEF complex are required for normal ER structure.; Authors - Andreas Gerondopoulos