RAB1B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83687-4-RR (same clone as 83687-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83687-4-RR (RAB1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83687-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 83687-4-RR (same clone as 83687-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83687-4-RR (RAB1B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83687-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 83687-4-RR (same clone as 83687-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83687-4-RR (RAB1B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83687-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 83687-4-RR (same clone as 83687-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 83687-4-RR (RAB1B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83687-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 83687-4-RR (same clone as 83687-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 83687-4-RR (RAB1B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83687-4-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 83687-4-RR (same clone as 83687-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using RAB1B antibody (83687-4-RR, Clone: 240635D9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83687-4-PBS in a different storage buffer formulation.

• 

  FC experiment of U-251 using 83687-4-RR (same clone as 83687-4-PBS)

  1x10^6 U-251 cells were intracellularly stained with 0.25 ug RAB1B Recombinant antibody (83687-4-RR, Clone:240635D9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83687-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83687-4-RR (same clone as 83687-4-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug RAB1B Recombinant antibody (83687-4-RR, Clone:240635D9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83687-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83687-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83687-4-RR against Human RAB1B were performed. The affinity constant is below 1 pM.

RAB1B Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83687-4-PBS

Clone No.240635D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

240635D9, EC:3.6.5.2, Ras related protein Rab 1B, Ras-related protein Rab-1B

---

Product Information

83687-4-PBS targets RAB1B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12197

  Product name: Recombinant human RAB1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC071169

  Sequence: MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC

• Full Name: RAB1B, member RAS oncogene family
• Calculated Molecular Weight: 201 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC071169
• Gene Symbol: RAB1B
• Gene ID (NCBI): 81876
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9H0U4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ras-related protein Rab-1B (RAB1B) belongs to the small GTPase superfamily and Rab family. Rab1b, a GTPase regulating secretory transport, was recently associated with targeting proteins to LDs in a Drosophila RNAi screen. Rab1b recruits lipid-synthesizing enzymes, facilitating Lipid droplets (LDs) growth. The small GTPase Rab1b interacts with diacylglycerol acyltransferase 2 to facilitate its targeting to the surface of lipid droplets. (PMID: 38809969). Rab1b, an extensively studied and established master regulator of ER-to-Golgi transport. The mechanism of Rab1b's function is to promote ER to LD surface targeting of those triglyceride-synthesizing enzymes that can associate with the unique lipid monolayer comprising the LD surface (PMID: 38809969). Rab1b is a regulatory protein involved in both COPI and COPII transport (PMID: 17429068).