RAB20 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAB20 Polyclonal antibody, PBS Only (29110-1-PBS)

• 

  WB analysis using 29110-1-AP (same clone as 29110-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29110-1-AP (RAB20 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29110-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 29110-1-AP (same clone as 29110-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 29110-1-AP (RAB20 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29110-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 29110-1-AP (same clone as 29110-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 29110-1-AP (RAB20 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29110-1-PBS in a different storage buffer formulation.

RAB20 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29110-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

29110-1-PBS targets RAB20 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30459

  Product name: Recombinant human RAB20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 115-234 aa of BC026025

  Sequence: VDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA

• Full Name: RAB20, member RAS oncogene family
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC026025
• Gene Symbol: RAB20
• Gene ID (NCBI): 55647
• RRID: AB_3086099
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NX57
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAB20 is a member of RAS oncogene family, it has no close relationship to any other members of RAB subfamily which consists of small GTP-binding proteins involved in the regulation of intracellullar vesicular transport. Firstly found highly expressed on the apical side of kidney tubuel epithelial cells, RAB20 was speculated to be involved in apical endocytosi and recylcing processes. So far, its function is not well known, however, RAB20 is recently found higher expressed in pancreatic adenocarcinomas than normal pancreas, which is proved by WB and IHC analyses, suggesting its promising role in diagnosis of pancreatic carcinogenesis. Catalog#11616-1-AP is a rabbit polyclonal antibody raised against full-length of human RAB20.