RAB27A Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAB27A Recombinant monoclonal antibody (87178-4-RR)

RAB27A Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87178-4-RR

Clone No.252463B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:3.6.5.2, GTP binding protein Ram, GTP-binding protein Ram, Rab 27, RAB27

• 

  WB analysis using 87178-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87178-4-RR (RAB27A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 87178-4-RR

  Biolayer interferometry (BLl) kinetic assays of 87178-4-RR against Human RAB27A were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HL-60 cells, Jurkat cells, K-562 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87178-4-RR targets RAB27A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12136

  Product name: Recombinant human RAB27A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-221 aa of BC107680

  Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

• Full Name: RAB27A, member RAS oncogene family
• Calculated Molecular Weight: 221 aa, 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC107680
• Gene Symbol: RAB27A
• Gene ID (NCBI): 5873
• RRID: AB_3745392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P51159
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rab27A is a member of a large family of Ras-related small GTPases. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Recent studies suggest that Rab27A is associated with melanosomes in pigmented cells and regulates melanosome transport via its interaction with actin-based cellular motors such as myosin Va and myosin VIIa. RAB27A is also required for regulated secretion in cytotoxic T lymphocytes. Rab27A is implicated in several diseases, including Griscelli syndrome, choroideremia, and the Hermansky-Pudlak syndrome mouse model, gunmetal.